PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00415g00079.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 463aa    MW: 50644.4 Da    PI: 4.694
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00415g00079.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.24.5e-34250304155
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               k+r+rWtpeLHe+Fveav++LGGse+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  Peaxi162Scf00415g00079.1 250 KQRMRWTPELHEAFVEAVNKLGGSERATPKGVLKLMKVEGLTIYHVKSHLQKYRT 304
                               79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.073247307IPR017930Myb domain
SuperFamilySSF466896.09E-18248304IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-31248306IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-25250304IPR006447Myb domain, plants
PfamPF002492.8E-10252303IPR001005SANT/Myb domain
PfamPF143797.8E-26336383IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MEARPAVSVQ SVVASQLSNC GASGAFSSSF PMLPTALEEK YPKLPDSQLA SMEKELRQRP  60
GTVLSPLSSN SGAVGLMFSS SSGFSADLHF SSVLPQDKLS GPAPFISQST NSETSMLLHH  120
PGVLQSTASS QYLNENNEPW CTDPLPDFLD YSVNDPVQNS QLASSNKQSD WQEWADLVIN  180
DEDALTANWN EIMGGTSIAD SEQKMQYQEE SQPSNFPMQQ VQASQQIPAV PVENSVIAPA  240
SSPASSAASK QRMRWTPELH EAFVEAVNKL GGSERATPKG VLKLMKVEGL TIYHVKSHLQ  300
KYRTARYKPE ASEEGSSEKK RSSIDDLSSL DLKTGIEITE ALRLQMEVQK RLHEQLEIQR  360
NLQLRIEEQG RYLQMMFEKQ CKSIPGADLA KGSSSTADDA FAQLSDAVQS SSAKNDLGVS  420
QVDIAKKVGE KQKEQEREVL GDTEANITST SDSPPLKRSK LDE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00532DAPTransfer from AT5G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754481e-176HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009781297.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_009781296.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
SwissprotQ8GUN51e-101PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLK4CUV90.0K4CUV9_SOLLC; Uncharacterized protein
STRINGSolyc09g072830.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27532349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.22e-85G2-like family protein